PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009778708.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 304aa    MW: 34913.4 Da    PI: 4.7703
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009778708.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.32.4e-26134183352
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       +s e++skyF++pi++AAkeL+++lT+LK++CR++GI+RWPhRk+ sl
  XP_009778708.1 134 RMLSRETISKYFYMPITQAAKELNIGLTLLKKRCRELGIRRWPHRKLMSL 183
                     57899******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.518118204IPR003035RWP-RK domain
PfamPF020421.2E-21136183IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MSTNQENHQD VFSLPIQLPS LEFSGYSGHH AIDYQYDLSI QEFDANPFME FTLDDPLYSS  60
FYSTPLQCLT PAAGELYYGD LGNGFGLSDE LGSGNNQLLL CDKNQEIIIT NDHVEEIKKR  120
EKDSRQIEEI NSTRMLSRET ISKYFYMPIT QAAKELNIGL TLLKKRCREL GIRRWPHRKL  180
MSLQTLIKNV KELEKGGGSG MEQKLKDVIK LLEEEKKMLE EVPDMELEEK TKRLRQACFK  240
ANYKRRKLMS MTELQASFGS YCNSNPAVGI GYGHREEEDD DYDDEEIKSL LADCFSSSSP  300
TLHE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009778708.10.0PREDICTED: protein RKD1
SwissprotQ9M9U92e-55RKD1_ARATH; Protein RKD1
TrEMBLK4BLA31e-127K4BLA3_SOLLC; Uncharacterized protein
STRINGSolyc03g116010.1.11e-127(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42742142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-51RWP-RK domain-containing protein